HORDB

ID: hor002028
Uniprot ID: P49921
Protein name: Progonadoliberin-1
Gene name: GNRH1
Organism: Sus scrofa (Pig)
Family: GnRH family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity; GO:0031530 gonadotropin-releasing hormone receptor binding
GO BP: GO:0000003 reproduction; GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: QHWSYGLRPGGKRNAENVIDSFQEMAKEVARLAEPQRFECTAHQPRSPLRDLKGALESLIEEETGQKT
Length: 68(24-91)
Propeptide: MEPIPKLLAGLLLLTLCVVGCSSQHWSYGLRPGGKRNAENVIDSFQEMAKEVARLAEPQRFECTAHQPRSPLRDLKGALESLIEEETGQKT
Signal peptide: MEPIPKLLAGLLLLTLCVVGCSS
Modification: T1 Pyrrolidone carboxylic acid;T10 Glycine amide
Glycosylation: NA
Mutagenesis: NA

Function: Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
Mechanism: NA
Cross BBB: NA
Target: GNRHR
Target Unid: P49922
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002028_AF2.pdb

hor002028_ESM.pdb

Mass:	893188	Formula:	C334H532N102O106S2
Absent amino acids:		Common amino acids:	E
pI:	6.52	Basic residues:	12
Polar residues:	16	Hydrophobic residues:	19
Hydrophobicity:	-98.38	Boman Index:	-18728
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	63.24
Instability Index:	7553.97	Extinction Coefficient cystines:	6990
Absorbance 280nm:	104.33